Protein Info for Psest_2496 in Pseudomonas stutzeri RCH2

Annotation: succinate dehydrogenase, flavoprotein subunit, E. coli/mitochondrial subgroup

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01816: succinate dehydrogenase, flavoprotein subunit
  • amino acids 8 to 590 (583 residues), 1001.9 bits, E=7.2e-306
• TIGR01812: succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  • amino acids 10 to 590 (581 residues), 843.1 bits, E=1e-257
• PF00890: FAD_binding_2
  • amino acids 10 to 407 (398 residues), 398 bits, E=1.2e-122
• PF01134: GIDA
  • amino acids 10 to 39 (30 residues), 19.8 bits, see alignment (E = 7.5e-08)
• PF02910: Succ_DH_flav_C
  • amino acids 462 to 590 (129 residues), 153.8 bits, E=4.8e-49

Best Hits

Swiss-Prot: 70% identical to SDHA_ECOL6: Succinate dehydrogenase flavoprotein subunit (sdhA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00239, succinate dehydrogenase flavoprotein subunit [EC: 1.3.99.1] (inferred from 99% identity to psa:PST_1873)

MetaCyc: 91% identical to succinate dehydrogenase flavoprotein subunit (Pseudomonas putida KT2440)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase flavoprotein subunit (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• partial TCA cycle (obligate autotrophs) (8/8 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle VII (acetate-producers) (8/9 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• succinate to cytochrome bd oxidase electron transfer (2/2 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• TCA cycle III (animals) (7/10 steps found)
• glycerol-3-phosphate to fumarate electron transfer (1/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (1/2 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (9/17 steps found)
• reductive TCA cycle II (5/12 steps found)
• pyruvate fermentation to propanoate I (1/7 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
• methylaspartate cycle (9/19 steps found)
• L-glutamate degradation VIII (to propanoate) (1/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Oxidative phosphorylation
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Sequence Analysis Tools

See L0GJW1 at UniProt or InterPro

Protein Sequence (590 amino acids)

>Psest_2496 succinate dehydrogenase, flavoprotein subunit, E. coli/mitochondrial subgroup (Pseudomonas stutzeri RCH2)
MANIRTLSFDAIIVGGGGAGMRAALQLAQSGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTEQGRIYQRP
FGGQSKDFGKGGQAARTCAAADRTGHALLHTLYQGNLKNNTVFLNEWYAVDLVKNQDGAV
VGVIAICIETGETVYIRSKATVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINKHGERFMERYAPNAKDLAGRDVVARSMVKEI
LAGNGCGPDGDHVMLKLDHLGEEVLHSRLPGICELSKTFAHVDPVVAPVPVVPTCHYMMG
GIATNIHGQAITQDANGNDTIIDGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALKDGIEHRGASDTDLDVALSRLAGLNERTTGEDVAPLRKELQNCMQNYFGVFRTGE
YMQKGIAQLVDLRQRIANVKISDKSQAFNTARIEALELQNLLEVAEATAIAAENRKESRG
AHAREDFEERDDENWLCHTLYFPGDKRVAKRAVNFAPKTVPAFEPKVRTY