Protein Info for HP15_2391 in Marinobacter adhaerens HP15

Annotation: conserved hypothetical protein, membrane

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details amino acids 343 to 360 (18 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details amino acids 404 to 424 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PH52 at UniProt or InterPro

Protein Sequence (428 amino acids)

>HP15_2391 conserved hypothetical protein, membrane (Marinobacter adhaerens HP15)
MNNRLNSASWLRINQRWKREVWYVPILGGAMALMMLRPLLMARLFDAPDFGTYIAGLLVS
SSFCVLGCLGLQPKLQRSMPMGFVARKELASQILLFQSILVALLLALVGCLIGVADLSIA
GLSPGTFAISVVHGFSQQIFVLSTVESRSRGQALRFSWQNMGRAISIITAAGMVAWYVRS
PEETLLTEAIISILLASLILVKSSTRHSTGLRALFLLAIRRLAVIRWSEPLSLMLVMLVG
FSLANADRWVAVTVLPPVQFAWYGFAWILLTAAQSIQTITNSSLYPALAKRFAIGGGRAS
FSLAWKASLVFLILGGIGVLPSYFLLEEIIVNWFEDYQRSLEILPIFLAVASIRISDFWS
SHLLVSGKERLLLAVNCFSGAFVFILFSLLGYFQSVDKLGITELAHLALTLTAVNYLLVL
IFSLKFRR