Protein Info for PGA1_c24700 in Phaeobacter inhibens DSM 17395

Annotation: pyrroline-5-carboxylate reductase ProC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 78% identity to sil:SPO0911)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

L-arginine degradation VI (arginase 2 pathway) (4/4 steps found)
L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
L-proline biosynthesis III (from L-ornithine) (3/3 steps found)
L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)

KEGG Metabolic Maps

Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E325 at UniProt or InterPro

Protein Sequence (275 amino acids)

>PGA1_c24700 pyrroline-5-carboxylate reductase ProC (Phaeobacter inhibens DSM 17395)
MQVSEIAARRIALLGCGKMGSAMLAGWLDRGVSPEAVWVIDPNPSDWLRQTGVHINAPLP
EAGADAPGIVLIAVKPQMMGEALPQLQQLGNGETLFISVAAGTSIATYESLLGAETPIVR
AMPNTPAAVGRGITAIIGNASASADDVIRADALLKAIGQTVRLQSEAQMDAVTGVSGSGP
AYVFHLIETLAAAGEAEGLPAELAMQLAKATVAGAGALAEAAEETPAELRVNVTSPNGTT
QAALEVLMDEDNGFPPLLRRAVAAASNRSKELSRG