Protein Info for PGA1_c02550 in Phaeobacter inhibens DSM 17395

Annotation: protocatechuate 3,4-dioxygenase alpha chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 54% identical to PCXA_ACIAD: Protocatechuate 3,4-dioxygenase alpha chain (pcaG) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K00448, protocatechuate 3,4-dioxygenase, alpha subunit [EC: 1.13.11.3] (inferred from 75% identity to sil:SPOA0043)

Predicted SEED Role

"Protocatechuate 3,4-dioxygenase alpha chain (EC 1.13.11.3)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 1.13.11.3)

MetaCyc Pathways

protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
aromatic compounds degradation via β-ketoadipate (7/9 steps found)
toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
4-sulfocatechol degradation (1/4 steps found)
superpathway of aerobic toluene degradation (11/30 steps found)
superpathway of aromatic compound degradation via 3-oxoadipate (14/35 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.3

Use Curated BLAST to search for 1.13.11.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DX20 at UniProt or InterPro

Protein Sequence (214 amino acids)

>PGA1_c02550 protocatechuate 3,4-dioxygenase alpha chain (Phaeobacter inhibens DSM 17395)
MTSLKETPSQTAGPYVHIGLAPGAAGFDIYETELGQDIAGPEAKGQRIRIEGRVLDGTGT
PLKDVLIEVWQANAKGIYAHRETPQPEGEPQQVEAGFRGWGRVISDFDTGDWQFETVKPG
PVRGRDSRMMAPHINLWIVARGINLGLNTRLYFEEEHEANGNDPVLKLIEQTARRSTLLA
RRQMQADTGTAETPLVYRFDIHLQGPDETVFFDT