Protein Info for HP15_2372 in Marinobacter adhaerens HP15

Annotation: protein containing flagellin N-terminal / flagellin C-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 PF00669: Flagellin_N" amino acids 5 to 142 (138 residues), 158.7 bits, see alignment E=1.5e-50 PF07196: Flagellin_IN" amino acids 432 to 465 (34 residues), 26.4 bits, see alignment (E = 9.4e-10) PF00700: Flagellin_C" amino acids 523 to 606 (84 residues), 92.8 bits, see alignment E=2e-30

Best Hits

Predicted SEED Role

"Flagellin protein FlaB" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PH33 at UniProt or InterPro

Protein Sequence (608 amino acids)

>HP15_2372 protein containing flagellin N-terminal / flagellin C-terminal (Marinobacter adhaerens HP15)
MPQVINTNIASLNAQRNLNASQGQANVALERLSSGLRINSAKDDAAGLAISERFQSQIAG
LNQAQRNANDGISLAQTAEGAMDEITNNLQRIRELAVQSANATNSPSDRQALNQEVQQRI
EEINRIAAQTSFNGLKVLDGTFDTQTFQVGANTGETIAISGLDSRGSQIGSVLKETAGLS
TDVIGPGEAATTDLNVSTLDFTTDLTITGTIGGEDVSIAAASYADADALATALQTEIQNG
GGDLAEVTVTVDGNTLTITNPTSTDFPVTSFSISDASGVAGTTADNTGGGTNIAGAGGTD
TIDVSGLDFTNGGTITFGGVDYPITAGSDFDDVAAELQAQLQANEDPDLTVANAGGTLTI
TNGGAATPADDVDPGTISIEDGTGTPNNSIGGALTSIDGAEDLTLAQSFANGDTYNFEVD
INGDVFTFEGMGSLSDIVSQINAQSTQTGIRANLNSDNDEIIFSSQFGEAFDITIDADID
GDGIFGGVDDYNQAVNATIADDTYAVTGVDISSRDGADLAMISIDYAIDTINGYRAELGA
VQNRFESTIANLATTSENLSASNSRIRDADFAAESAELARTQVLQQAGLSVLAQANARPQ
QVLQLLQG