Protein Info for HP15_2367 in Marinobacter adhaerens HP15

Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR00032: argininosuccinate synthase" amino acids 11 to 401 (391 residues), 473.4 bits, see alignment E=3.7e-146 PF00764: Arginosuc_synth" amino acids 11 to 172 (162 residues), 220 bits, see alignment E=1.9e-69 PF20979: Arginosuc_syn_C" amino acids 182 to 400 (219 residues), 276.6 bits, see alignment E=1.4e-86

Best Hits

Swiss-Prot: 98% identical to ASSY_MARHV: Argininosuccinate synthase (argG) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 98% identity to maq:Maqu_2588)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PH28 at UniProt or InterPro

Protein Sequence (408 amino acids)

>HP15_2367 argininosuccinate synthase (Marinobacter adhaerens HP15)
MWSKGMSDIKKVVLAYSGGLDTSVIVRWLQDTYNCEVVTFTADIGQGEEVEPARAKAEAL
GVKEIYIEDLREEFVRDYVFPMFRANTIYEGEYLLGTSIARPLIAKRLIDIANETGADAI
SHGATGKGNDQVRFELGAYALKPGVKVIAPWREWDLNSREKLLKYCEERNIPVEMKKGKS
PYSMDANLLHISYEGINLEDPWAEAEEDMWRWSVSPEAAPDEPTYVELTYKKGDIVAIDG
QDMKPHLVLETLNKLAGANGIGRLDIVENRYVGMKSRGCYETPGGTIMLRAHRAIESITL
DREVAHLKDSIMPRYAEVIYNGYWWSPEREALQALIDQTQNYVNGTVRLKLYKGNVDVVG
RKSEDSLFDEKIATFEEDQGAYDQKDAEGFIKLNALRLRIAAGKGRKL