Protein Info for Psest_2462 in Pseudomonas stutzeri RCH2

Annotation: selenium donor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR00476: selenide, water dikinase" amino acids 6 to 311 (306 residues), 451.1 bits, see alignment E=9.7e-140 PF00586: AIRS" amino acids 49 to 156 (108 residues), 92.3 bits, see alignment E=2.7e-30 PF02769: AIRS_C" amino acids 169 to 343 (175 residues), 79 bits, see alignment E=4.7e-26

Best Hits

Swiss-Prot: 86% identical to SELD_PSESM: Selenide, water dikinase (selD) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K01008, selenide, water dikinase [EC: 2.7.9.3] (inferred from 96% identity to psa:PST_1903)

MetaCyc: 66% identical to selenide, water dikinase (Escherichia coli K-12 substr. MG1655)
Selenide, water dikinase. [EC: 2.7.9.3]

Predicted SEED Role

"Selenide,water dikinase (EC 2.7.9.3)" in subsystem Selenocysteine metabolism (EC 2.7.9.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.9.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNV2 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Psest_2462 selenium donor protein (Pseudomonas stutzeri RCH2)
MSEPIRLTQYSHGAGCGCKISPKVLDVILAGSGAQNLDPRLWVGNASRDDAAVYGIDEER
GVVSTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGDPLMAIAILGWPVNVLPPEVAREV
IAGGRAVCDAAGIPLAGGHSIDAPEPIFGLAVTGLVNKQQMKRNDTATPGCRLYLTKPLG
IGILTTAEKKAKLRAEDVGLARDWMCTLNTPGSRFGKLEGVRAMTDVTGFGLLGHLVEMA
DGSGLTAEIDYARVPRLPGIEYYLEQGCVPGGTQRNFDSYGERIAALDERHKQLLCDPQT
SGGLLVAVAPEGEAEFLAVCAELGLNLQPIGQLVEARGHAVEVH