Protein Info for Psest_2458 in Pseudomonas stutzeri RCH2

Annotation: MoxR-like ATPases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF20030: bpMoxR" amino acids 4 to 182 (179 residues), 31.7 bits, see alignment E=2e-11 PF07726: AAA_3" amino acids 35 to 165 (131 residues), 208.2 bits, see alignment E=8.9e-66 PF07728: AAA_5" amino acids 42 to 163 (122 residues), 44.3 bits, see alignment E=4.6e-15 PF17863: AAA_lid_2" amino acids 228 to 288 (61 residues), 80.7 bits, see alignment E=1.4e-26

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 97% identity to psa:PST_1907)

Predicted SEED Role

"FIG022979: MoxR-like ATPases"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNQ7 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Psest_2458 MoxR-like ATPases (Pseudomonas stutzeri RCH2)
MRTRLDACLRAVNEVLLGKEAQVRLALTCLLARGHLLVEDMPGMGKTTLSHTLAKVLGLE
FQRIQFTSDLLPGDILGTSVFDKDSGQFVFHPGPIFAELVLADEINRATPKSQSALLEAM
EEGQVTIEGATRPLPEPFFVIATQNPVSSGGTFALPESQLDRFLMRVSLGYPAKAAEKAL
LLGESRRDLLLRLEPLLEHDELRAIQDAVSQVRASDALVDYVLRLVEATRTQPQFAWGLS
PRGSLALLAAARAWAFLDGRDYVIPEDVQAVLPTVVGHRLRERADATGHGGGALVQWLLR
EVPAL