Protein Info for HP15_2352 in Marinobacter adhaerens HP15

Annotation: sensory box sensor/GGDEF/EAL domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 161 to 185 (25 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 251 to 412 (162 residues), 93.6 bits, see alignment E=5.5e-31 PF00990: GGDEF" amino acids 253 to 410 (158 residues), 115.5 bits, see alignment E=2.1e-37 PF00563: EAL" amino acids 430 to 664 (235 residues), 252.2 bits, see alignment E=4.5e-79

Best Hits

KEGG orthology group: None (inferred from 78% identity to maq:Maqu_2024)

Predicted SEED Role

"GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGK5 at UniProt or InterPro

Protein Sequence (686 amino acids)

>HP15_2352 sensory box sensor/GGDEF/EAL domain protein (Marinobacter adhaerens HP15)
MQNSFEVEHRLGYRILRWILAVALASGVVVSAIQVILDAQRVSRGLDSDAKQTIAMVKDA
ATQAVFSIDAELAQQVVDGLFAKEAVHMARIVHPDGDPLGDRSRPLQETAFRPVTDPIFD
ADRLYREPLFREGNPEDVYGFLDVHYDTAAAARTWLDRAAVTFASGMATALILGMVLFYV
FHLLLTRPLLRIVNSVRQVDPAHPDDRLVTTPSGHQSDELGLWVNATNNLLVAIGDSQKR
HREAEDRVSRLSRYDQLTGLPSRDTFMELLVRDIEDAARRNAQLSLIVCGIDDFKSVNEQ
CGFRSGDLILQTVADRLTNKLDNARFTIARLGSDQFVVVQKGLRDGFQAADTAERILACV
NEPMLVEDQNISISATLGVALYPSDTSKADRLLQSAEQTMTLAKQNGHNHFQFYVASIDQ
EIRDRKQLEKDLSQALGNHQFHLVYQPQINLESKRVIGAEALLRWEHPTRGTVPPDFFIP
VAEANGSIVEIGQWVLDQACWQAARWASDGSPLRIAVNLSAVQLRQESIVDDILDTLRRH
KIPAGRLELEVTETSFMTNLSDAVAKLHRLNKAGISIAVDDFGTGYSSLTYLKQMPVQHL
KIDKQFIRDLLVNEEDTRIANTIIDLGKSLNLSVVAEGVETAEQEYYLSQRGCKLAQGYF
FSKPLPPREFETFVKGFHEQIVENNL