Protein Info for Psest_0241 in Pseudomonas stutzeri RCH2

Annotation: Na+/phosphate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 transmembrane" amino acids 5 to 22 (18 residues), see Phobius details amino acids 28 to 46 (19 residues), see Phobius details amino acids 71 to 97 (27 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 37 to 175 (139 residues), 118.9 bits, see alignment E=8.9e-39 amino acids 170 to 277 (108 residues), 44.4 bits, see alignment E=8.9e-16

Best Hits

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 89% identity to psa:PST_4005)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGG3 at UniProt or InterPro

Protein Sequence (612 amino acids)

>Psest_0241 Na+/phosphate symporter (Pseudomonas stutzeri RCH2)
MNNRYFKILLPIVGVLMLSWSFWANDGWLELCAGLALFLFGMQCLEEGLRQLAGSKLEQL
LARSTATPLKGLLFGISGTMLLQSSTLVSLLTIAFISTGLIKLAGGIAILFGANLGSTTG
IWLLALAGQNVSLSPLALPLLVFGVLASFTGDKGKAAGRIVLGIAFIFLGIDQIKDGFSS
FGSLDLSHYHAGGLKGQLLFVAIGLLATVVLQSSHATLMLTLTALAAGQLDLGQALATAI
GANVGTTVTAALVGSLGGNRSAQRLALAHVLFNVVTALLALVLLLPLTDLVRWVTAPLGL
GGNTLIQLALFHSLFNAMGVALFWPFQRQLAELLQRVLPDRVEPTVLITELAQAMPAEPL
THARYLNDRALDSADAAASAVAQELQHLARLSLEVICHATYLPVDQLRQQGKIDEALINA
KPEAQALDAERLYQRHIKGVYSDLLAFMGRLELPLDESHQAFWLSCQVAALQLVDAVKDA
KHLQKNLGHYLRTDESAARQAYVELRRHLLESLREIRALNHSELPDELWRERLNWLDERA
AQFDTEFRRRLFESIRNHKLDGLQTSSLMNDLGYASRIIQSLRNALLLGEGHELTRQLRQ
LAEDDGPVILQL