Protein Info for HP15_2345 in Marinobacter adhaerens HP15

Annotation: 3-oxoacyl-(acyl-carrier protein) reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 230 to 414 (185 residues), 146.9 bits, E=1.1e-46
• PF01370: Epimerase
  • amino acids 232 to 372 (141 residues), 32.5 bits, E=1.2e-11
• PF08659: KR
  • amino acids 232 to 401 (170 residues), 66.7 bits, E=5.3e-22
• PF13561: adh_short_C2
  • amino acids 236 to 461 (226 residues), 164.3 bits, E=7.5e-52

Best Hits

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 82% identity to maq:Maqu_2017)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (20/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (16/16 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
• biotin biosynthesis I (13/15 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• cis-vaccenate biosynthesis (5/5 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (25/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (25/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (25/34 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• stearate biosynthesis IV (4/6 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (20/205 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

See E4PGJ8 at UniProt or InterPro

Protein Sequence (468 amino acids)

>HP15_2345 3-oxoacyl-(acyl-carrier protein) reductase (Marinobacter adhaerens HP15)
MSDLYLRIVNTPVGKTAAQSLGLPAPVPLKRLKRTDQPFIEGDVLVGAASGGKAIAAIGS
TLSASAATLHHASGNERLKDSSKAGNKARPMDLNSEIDQKFSALVFDATGFKGPDDLRAL
YDFFHPTIKKLGGNARVLVIGQNPATCRKAPQAAAQQALEGFVRSIGKEIGKKGSTANLL
WMAPGAEQQLESSVRFFLSARSAYVSGQVVRIGKSDSAPATNPVAPLTGKVALVTGASRG
IGAAIAKTLARDGATVIGLDIPPAMEDLQRVTSAINGKALACDITDEKAPTLIADFIDEH
FGGVDLVIHNAGITRDKTLGNMPEHFWDMTIAVNLTAEELIDEELAKRELMKENGRIVCI
SSISGIAGNFGQTNYSTAKSGVIGYVEAMARQLKKGVTINAVAPGFIETQMTAAMPVTIR
EAGRRMNSLSQGGQPVDVAETIAWYCSPASSGVNGNVVRVCGQSLIGK