Protein Info for PGA1_c24240 in Phaeobacter inhibens DSM 17395

Annotation: putative S-adenosylmethionine uptake transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 49 to 68 (20 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details PF00892: EamA" amino acids 15 to 149 (135 residues), 56.4 bits, see alignment E=2.1e-19 amino acids 159 to 288 (130 residues), 56.3 bits, see alignment E=2.2e-19

Best Hits

KEGG orthology group: None (inferred from 74% identity to sil:SPO0959)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E2X8 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PGA1_c24240 putative S-adenosylmethionine uptake transporter (Phaeobacter inhibens DSM 17395)
MLGLMIITRQNPALAAALILLATVFIAGTTLVAKALGTDALGAPLHPLQISFGRFVFAFL
AISTLVAVRRPRFTAPHWGLHLGRTSFGWMGVTLMFAAVAYIPLADATAITFLNPVFGML
LAIPLLGETVGRWRWAAAVIALLGAMVLLRPTPASFQPASLLALAAAAVMGLELIFIKRL
AGREKPLQILWFNNLLGSVIASVAVIAVWQPPTAEQWALMVALGSMMACAQGCFINGMAR
ADASFVAPFSYATLIFAAIYDFAVFAEAPDAITILGAVIILAGAALLAWREGRLRPPSLH
VDPGAQADQDFNR