Protein Info for HP15_2338 in Marinobacter adhaerens HP15
Annotation: peptidase C26
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 83% identity to maq:Maqu_2009)Predicted SEED Role
"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)
MetaCyc Pathways
- superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
- L-citrulline biosynthesis (7/8 steps found)
- L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
- glutaminyl-tRNAgln biosynthesis via transamidation (4/4 steps found)
- L-glutamate and L-glutamine biosynthesis (6/7 steps found)
- ammonia assimilation cycle III (3/3 steps found)
- superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
- 4-aminobenzoate biosynthesis I (2/2 steps found)
- L-glutamate biosynthesis I (2/2 steps found)
- superpathway of L-citrulline metabolism (9/12 steps found)
- L-glutamine degradation I (1/1 steps found)
- superpathway of chorismate metabolism (41/59 steps found)
- superpathway of candicidin biosynthesis (3/11 steps found)
- chloramphenicol biosynthesis (1/9 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.6.1.85
Use Curated BLAST to search for 2.6.1.85
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PGJ1 at UniProt or InterPro
Protein Sequence (244 amino acids)
>HP15_2338 peptidase C26 (Marinobacter adhaerens HP15) MSEESKEQELEVPGLTIGISGPARKSLAHRLISLGLRLHGARTHYIRPGSRVAVPMLDGL VLSGGTHVHPERYGQEPQVTANYDRKRDKTDQSLLEQAEAIGIPVLGICRGAQFINVFHG GSLCQNVTPLRVNTRHRPLLLPLQTVRLVTHSRLEQAMRSPVIGANRIHSQAIKRLGRNL RVTAVDNDLFVQAIESTGRQWLTGIQWHPEYLLYHGGHRRIFGQFVDAARRYKLARLEPD SDDA