Protein Info for Psest_2430 in Pseudomonas stutzeri RCH2

Annotation: AraC-type DNA-binding domain-containing proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF02311: AraC_binding" amino acids 17 to 144 (128 residues), 95.4 bits, see alignment E=3.8e-31 PF12833: HTH_18" amino acids 194 to 263 (70 residues), 66.7 bits, see alignment E=2.8e-22

Best Hits

KEGG orthology group: None (inferred from 90% identity to psa:PST_1932)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMD0 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Psest_2430 AraC-type DNA-binding domain-containing proteins (Pseudomonas stutzeri RCH2)
MHMSDRDWVRRPHEPGRFERLEAYFAGYGFAPHRHDTYAIGCTVSGVHRFNYRKCARNSL
PGDTFVLHPDELHDGEAGSEAGFRYRAVYIEPALLQGPLGGQPLPFIDDGVSRDPRLQRA
IGSLLQCLDRPLEGLEEQDALYDLAQIMAKVARTKGRRRSVDFRAAERARDYIHEFLTQP
ISLDELERVSDRDRWSLSRDFRALFGTSPYRYLTLRRLDQVRRLLLGGSAPSDAALIAGF
VDQSHMSRQFKQAYGLPPGHWLRLIRRP