Protein Info for Psest_2425 in Pseudomonas stutzeri RCH2

Annotation: Trk-type K+ transport systems, membrane components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 43 to 59 (17 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 294 to 324 (31 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details PF02386: TrkH" amino acids 39 to 420 (382 residues), 184.5 bits, see alignment E=1.4e-58

Best Hits

KEGG orthology group: None (inferred from 97% identity to psa:PST_1936)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMC5 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Psest_2425 Trk-type K+ transport systems, membrane components (Pseudomonas stutzeri RCH2)
MKSLLHPGRAVALVFLFAILCGTALLSLPIAHASGETGPLLAAFFTAVSAVCVTGLVVVD
TGTYWSTFGQVVIMVLFQVGGFGMMTLATLLGLLVNRSFRLRTKLVAQAESHVLGLGDIS
SVAKLVLVVTLVMELVVMLLLTLRLHLSYGLGWGEAAWSGLFHAVSAFNNAGFSIHGDGL
VRYATDGFILLPVMSAIIIGGIGFPVLNDLRRRWSDPRHWSLHTKLTLSGTAVLLLGGFM
TVLLFEWSNPGTLGPMAWVDKLLSAAFVSVSARTAGFNAIDIGALTHESWALHYFLMFIG
GGSAGTAGGVKVGTVAILALLVIAEIRGRADSEAFGRRVGSSAQRQAITVLVLGSAMVVL
GTLVILRDTDIPTDQVIFEVISAFGTVGLSTGITADLPETSQLMLTLLMYVGRVGTITLA
ASLALGEHRMPYRYPEEHPIVG