Protein Info for Psest_2424 in Pseudomonas stutzeri RCH2
Annotation: K+ transport systems, NAD-binding component
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 33% identical to KTRA_VIBAL: Ktr system potassium uptake protein A (ktrA) from Vibrio alginolyticus
KEGG orthology group: K03499, trk system potassium uptake protein TrkA (inferred from 97% identity to psa:PST_1937)Predicted SEED Role
"Trk system potassium uptake protein TrkA" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GLT1 at UniProt or InterPro
Protein Sequence (234 amino acids)
>Psest_2424 K+ transport systems, NAD-binding component (Pseudomonas stutzeri RCH2) MLAKLLFSEQFSFSKGDSVVVIGLGRFGSSVARSLTRLGHDVMGIDQAAEPVHTWADLLT HAVQADSTNVMALRQLGVADFPHAIVGIGSDMAASLMTIMALTELGIKDIWVKALTAEHG QIALRIGAHHVVYPEADMGERVAHLISGRMMDFIEFDDGFAIAKIHAPERIHNSTLAAAG VRETFGVTVVGLKRANQDFQHATPSTQVLPGDLLIVSGPTHDIQRFAGQGRKGS