Protein Info for Psest_2421 in Pseudomonas stutzeri RCH2

Annotation: formate dehydrogenase family accessory protein FdhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 TIGR00129: formate dehydrogenase family accessory protein FdhD" amino acids 22 to 254 (233 residues), 141.9 bits, see alignment E=1.1e-45 PF02634: FdhD-NarQ" amino acids 23 to 255 (233 residues), 207.7 bits, see alignment E=1.1e-65

Best Hits

Swiss-Prot: 40% identical to FDHD_BORPD: Sulfur carrier protein FdhD (fdhD) from Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)

KEGG orthology group: K02379, FdhD protein (inferred from 91% identity to psa:PST_1940)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJK8 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Psest_2421 formate dehydrogenase family accessory protein FdhD (Pseudomonas stutzeri RCH2)
MLYATLKSTDLAEPHDARAALLAEECALAISYNGLNHAVMMVTPQDLEEFVVGFSLAGGL
IERIDDLRGLRLLGDGSARRAELQISPRAFWTLKQKRRQLAGTSGCGLCGVDALEQALPL
LVPLQPAALPPEGHFHELRQRIASAQLLARDSGALHAALYVDGNGEIALCREDIGRHNAL
DKLIGALTLQRRTPGEGFVVVTSRCLELIHKAVRAGIGTLVSLSAPTHLTVEWARRHHLN
LIHLPHHSAPRVYSPAPATHEQNGCHP