Protein Info for Psest_2419 in Pseudomonas stutzeri RCH2

Annotation: AraC-type DNA-binding domain-containing proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF12625: Arabinose_bd" amino acids 32 to 213 (182 residues), 93.2 bits, see alignment E=3.3e-30 PF12833: HTH_18" amino acids 264 to 337 (74 residues), 53.4 bits, see alignment E=3.9e-18

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_1942)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLS5 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Psest_2419 AraC-type DNA-binding domain-containing proteins (Pseudomonas stutzeri RCH2)
MESPLRWYDWDTRFIAAHHQPAVLLDLALSRGIDSHALLRGSGLFYEDVASGRARVSPEQ
LLTLIGNTERLLGAADSSFLFGQRLLPGHYGDVSLALANACNLEQALERLCQFRALLCPL
LAPRLLLDEQQLHIYWLDNGSAGRHQRFLIEAHLTAIVALCKRGSGLRLPWRFQFAYSQP
RHVEQYWVHLGDALQFDRHLTLLSLPREYLHQPWPDASATVGQVAQQASQQQIDALEGPC
AFLDAFYQYLHDHIREPLNLERVAVAFAMSPATLKRKLAKHGTHFQEQLDLVRTHVALYL
YQSQGLGNEAVARHLGFNDTTNFRRAFKRWTGVVPSGLQPLFDAP