Protein Info for PGA1_c24020 in Phaeobacter inhibens DSM 17395

Annotation: putative outer membrane efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 31 to 440 (410 residues), 265.6 bits, see alignment E=4e-83 PF02321: OEP" amino acids 48 to 223 (176 residues), 51.7 bits, see alignment E=4.8e-18 amino acids 249 to 425 (177 residues), 68.9 bits, see alignment E=2.4e-23

Best Hits

KEGG orthology group: K12340, outer membrane channel protein TolC (inferred from 64% identity to sit:TM1040_1991)

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYV8 at UniProt or InterPro

Protein Sequence (472 amino acids)

>PGA1_c24020 putative outer membrane efflux protein (Phaeobacter inhibens DSM 17395)
MRNKLTANLFKAFVFAGSAALLLGAPKQAAADNLSDAMIGAYNTSGLLEQNRALLRAQDE
NVAVAVARLRPVVDWVAQAERRYVRTGFGSFAVSNHDSSISTALDVSWLLFDNGVSRLNQ
MAAQETVLATRQALIDIEQQVLFAAVQAYVNVLLQQDTVSLRRNNLRLLREELRAANDRF
EVGEVTRTDVALAESRVAGAQASLIESQGDLLNAKATYVQAVGREPGTIAGQPPLPQRVA
SLQSAEAIAMRNHPSLLTQQHAVKAADLSAQSASRGLGPTVNFRASVGHGEDPSGSGTSD
TSSASVVLSQRLYAGGAVASARRASIARLQAERGALITTQRSVVQDVSEAFVVLEAARAS
LVSSNEQVRAARVAFDGIREEATLGARTTLDVLEAEQELLNAQTARVQSRANQALAAYAL
LQAQGLLTAEHLGLAVEIYDPTLYYNLVKDAPAHVSQRSKDLDRVMRALGKN