Protein Info for PGA1_c02490 in Phaeobacter inhibens DSM 17395

Annotation: sporulation protein R-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 PF04293: SpoVR" amino acids 6 to 432 (427 residues), 541 bits, see alignment E=1.6e-166 PF24755: SpoVR_C" amino acids 436 to 490 (55 residues), 86.3 bits, see alignment 1.1e-28

Best Hits

KEGG orthology group: K06415, stage V sporulation protein R (inferred from 84% identity to sit:TM1040_0535)

Predicted SEED Role

"FIG004684: SpoVR-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EIM5 at UniProt or InterPro

Protein Sequence (492 amino acids)

>PGA1_c02490 sporulation protein R-like protein (Phaeobacter inhibens DSM 17395)
MFTGPEWTFQLLEVARDAIEEIALNDLGLDVYPNQIEIISAEQMLDAYSCVGLPLMYQHW
SFGKHFARDEALYRTGRQGLAYEIVINSNPCISYNMEENTMAMQTLVMAHAAFGHNHFFK
NNYLFQQWTDAAGIHDYLAFAKNYISACEERYGLSAVEEILDAAHALQSQGVFRYGRPPK
PTTEELAAMQKVREGYESAQSVLDIWTDATLGQDKLEQIKDEPYSARRKLMNLPQENLLY
FLEKHSPVLDPWQCEILRIVRMLAQYLYPQKQTKVMNEGCATFVHYYIINKLFEQGRLTE
GAYMEMMHSHTNVVLQPEYDDPRYSGINPYALGFAMMQDIRRICENPTDEDREWFPDFAG
DPDWRRVMRDAWANYRDESFIQQFLSPHLIRKFKLFTLADDADQSHLVVSQIHNRSGYRS
VRRDLAHSYDLAYLEPDIQVTDADLKGDRELKLTHTVRDGIHLSEEDRDEVLKHLRRLWG
YDVSLEAVDAGG