Protein Info for Psest_2409 in Pseudomonas stutzeri RCH2

Annotation: Serine/threonine protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 563 to 582 (20 residues), see Phobius details PF13672: PP2C_2" amino acids 30 to 207 (178 residues), 59.3 bits, see alignment E=1.4e-19 PF07228: SpoIIE" amino acids 93 to 240 (148 residues), 29.5 bits, see alignment E=2.5e-10 PF00481: PP2C" amino acids 194 to 241 (48 residues), 23.3 bits, see alignment 1.7e-08 PF00069: Pkinase" amino acids 293 to 532 (240 residues), 114.5 bits, see alignment E=2e-36 PF07714: PK_Tyr_Ser-Thr" amino acids 302 to 531 (230 residues), 68.5 bits, see alignment E=2.1e-22 PF06293: Kdo" amino acids 365 to 428 (64 residues), 23.5 bits, see alignment E=1.2e-08

Best Hits

KEGG orthology group: None (inferred from 85% identity to psa:PST_1952)

Predicted SEED Role

"serine/threonine protein kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLR5 at UniProt or InterPro

Protein Sequence (583 amino acids)

>Psest_2409 Serine/threonine protein phosphatase (Pseudomonas stutzeri RCH2)
MRAGAFAQMKIPSQLAISLGQHSDRGCKPANQDFHGACVPTDAQLASKGIAIALADGISS
SEVSHVASETAVASFLSDYFCTSDAWSVKQSAQRVLVAINSWLHAQTRHSPHRYDRDRGY
VCTFSALVLKSASAHLFHVGDARIYRLRDGDLEQLTEDHRVRVSADTSYLGRALGIDRHL
EIDYRTLPLAVGDLFLLATDGVYEHIGAREVAQLVAEHGDDLDLAARRIVERALANGSDD
NLTAQLVRIDSLPEQAVDDVQRQLGELVLPPLLEPRMQFDGYRIVRELHVSSRSHVHLAV
DEASGATVVLKTPSLDLRGDAAYLERFLLEEWIARRLDNPHVVKACPPPRQRRYLYTVSE
FIDGQTLTQWMLDHPQPDLETVRGIVEQIARGLRAFHRLEMLHQDLRPQNLMIDATGTLK
IIDFGSTRVAGLAERNAPGTQDNLLGTAAYTAPEYFLGEAGTPRSDQYSLAVIAYQLLSG
RLPYGADVARARTTAAQKRLCYQPLRHAQRDIPAWIDEVLGKALHPDPSRRYAELSEFVF
ELRQPNPAFLNRARPPLLERNPLLFWKGLSLLLAVTVVLLLLR