Protein Info for Psest_2405 in Pseudomonas stutzeri RCH2
Annotation: NAD-dependent protein deacetylases, SIR2 family
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 65% identical to NPD1_PSEAE: NAD-dependent protein deacylase 1 (cobB1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K12410, NAD-dependent deacetylase [EC: 3.5.1.-] (inferred from 86% identity to psa:PST_1956)Predicted SEED Role
"NAD-dependent protein deacetylase of SIR2 family" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Redox-dependent regulation of nucleus processes
KEGG Metabolic Maps
- 1,4-Dichlorobenzene degradation
- Caprolactam degradation
- Glutathione metabolism
- Lipopolysaccharide biosynthesis
- Lysine biosynthesis
- Nicotinate and nicotinamide metabolism
- Nucleotide sugars metabolism
- Sphingolipid metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.5.1.-
Use Curated BLAST to search for 3.5.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GMA8 at UniProt or InterPro
Protein Sequence (252 amino acids)
>Psest_2405 NAD-dependent protein deacetylases, SIR2 family (Pseudomonas stutzeri RCH2) MIPASLLSSMRSARHVVVFTGAGVSAESGIPTFRDALTGLWERFDASELATADAFRRDPA LVWGWYEWRRMRVLQAQPNPAHLAIAELARHVPQLTLITQNVDDLHERAGSQAVIHLHGS LHRPRCFACAREPAEPLPAPDEPEDGRRLEPPRCSHCGGRLRPGVVWFGESLPVAALNAA FQAAGECDLLLSVGTSGVVYPAAEVPHRARDAGATVVHVNPQGEPTAGNREYLIALPAGE ALPELLRAAFGA