Protein Info for Psest_2403 in Pseudomonas stutzeri RCH2

Annotation: Methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 66 to 83 (18 residues), see Phobius details amino acids 89 to 106 (18 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details PF00015: MCPsignal" amino acids 280 to 463 (184 residues), 146.4 bits, see alignment E=4e-47

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 89% identity to psa:PST_1958)

Predicted SEED Role

"methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNH2 at UniProt or InterPro

Protein Sequence (497 amino acids)

>Psest_2403 Methyl-accepting chemotaxis protein (Pseudomonas stutzeri RCH2)
MNTESVTLQAHYLKADRIMLGVIWFLVAYSFAIAAFYGNWAQAFVIGGLTAVAVTTLHML
IPGQRLLRCVIGAAFMVLAALHINQAHGMLEMHFGIFALLAFLVYYRDWLPIVVAAATIA
VHHLSFFALQQQGAGVFLIPDGNWGEVFLHAFYVVLESAILIYLAIRANAEAREGEALLG
AAAAITAHPERIDLSYRSKASGPVTQRFNHLLDQLGELVGAVVRDTAGLGGTAANLSEAT
RQMRDGASRQLDETAYMVDAMQQMTVAIDDVAGHADRAAQAAQGASQKAGEGRNAVSGVR
SEIGTLAEHIEGTDRLVQDLAAQSEQIDRVLEVIRTIADQTNLLALNAAIEAARAGEQGR
GFAVVADEVRNLAQKTAASTTEIQGIISRLQQGSRKATEAMQNSRDSVGRCVGSSQQTTA
LLDAIASEIEAISQMNEMIAAATHEQTAVSADMGRHLQSVQQVAERNAGDASQLDNDGRQ
LHELAGRLGGLSGRFTV