Protein Info for PGA1_c23860 in Phaeobacter inhibens DSM 17395

Annotation: nitrile hydratase accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 PF21006: NHase_beta_N" amino acids 10 to 95 (86 residues), 35 bits, see alignment E=7.2e-13 TIGR03889: nitrile hydratase accessory protein" amino acids 16 to 87 (72 residues), 91.9 bits, see alignment E=9.7e-31

Best Hits

KEGG orthology group: None (inferred from 69% identity to sil:SPO1316)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DSM5 at UniProt or InterPro

Protein Sequence (118 amino acids)

>PGA1_c23860 nitrile hydratase accessory protein (Phaeobacter inhibens DSM 17395)
MSAFDTSTAKRPEPAFDQPWHAQVLALTVHLNENGAFSWGDWVSRFSATLRRHGLAKDLN
GGEDYFAAWLETLEQYLAEAGTVAAEEAEDMRRKWEVAYLATPHGQPVRLAEPAVQEG