Protein Info for Psest_0236 in Pseudomonas stutzeri RCH2

Annotation: Predicted SAM-dependent methyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF17785: PUA_3" amino acids 6 to 72 (67 residues), 50.2 bits, see alignment E=8.3e-17 PF10672: Methyltrans_SAM" amino acids 184 to 376 (193 residues), 57.7 bits, see alignment E=5.2e-19 PF02475: TRM5-TYW2_MTfase" amino acids 186 to 285 (100 residues), 29.8 bits, see alignment E=2.5e-10 PF03602: Cons_hypoth95" amino acids 215 to 303 (89 residues), 43.8 bits, see alignment E=1e-14 PF05175: MTS" amino acids 220 to 336 (117 residues), 31.3 bits, see alignment E=6.5e-11 PF13847: Methyltransf_31" amino acids 220 to 341 (122 residues), 31.9 bits, see alignment E=5e-11 PF09445: Methyltransf_15" amino acids 222 to 346 (125 residues), 36.7 bits, see alignment E=1.4e-12 PF01170: UPF0020" amino acids 244 to 340 (97 residues), 24.7 bits, see alignment E=7.7e-09

Best Hits

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 97% identity to psa:PST_4010)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGF7 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Psest_0236 Predicted SAM-dependent methyltransferases (Pseudomonas stutzeri RCH2)
MTLPSLRLKANADRRLRAGHLWVYSNEVDTAATPLAGFVAGDQAVLEAAGGKPLGIVGVS
PNNLICARLLSRDLKHSLDKSLLVHRIKVALSLRERLFEQPCYRLVYGDSDLLPGLVVDR
FFDILVVQLASATMERNKDAVLEALVQVLKPSGVLWKNDSSARDAEGLERYVDTAFGVVP
EWVALEENGVKFEAPVMQGQKTGWFYDHRMNRARLAPYVKGKRVLDLFSYIGGWGVQAAA
FGASEVFCVDASAFALDGVERNAALNGVAEKMTCVEGDAFEAMKELKNAEERFEVVITDP
PAFIKRKKDLKNGEAAYRRLNEAAMRLLNKDGILVSASCSMHLPEDDLQNILLGSARHLD
RNIQLLERGAQGPDHPVHPAIPETRYIKSLTCRILPNS