Protein Info for HP15_2288 in Marinobacter adhaerens HP15

Annotation: flagellar protein FhlB cytoplasmic domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 PF01312: Bac_export_2" amino acids 11 to 81 (71 residues), 69.4 bits, see alignment E=1.7e-23

Best Hits

Swiss-Prot: 32% identical to YLQH_BACSU: Uncharacterized protein YlqH (ylqH) from Bacillus subtilis (strain 168)

KEGG orthology group: K04061, flagellar biosynthesis protein (inferred from 78% identity to maq:Maqu_1962)

Predicted SEED Role

"FlhB domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGE1 at UniProt or InterPro

Protein Sequence (104 amino acids)

>HP15_2288 flagellar protein FhlB cytoplasmic domain protein (Marinobacter adhaerens HP15)
MTSETEHHSRAAVALKYDGEKAPTISATGTHELAEEIIRIAREHNVPLYENAELASILAR
LSLNEEIPESLYRVIAEILAFAFHIRGLTPDDRRPGESDDSVNQ