Protein Info for Psest_2382 in Pseudomonas stutzeri RCH2

Annotation: coenzyme PQQ biosynthesis probable peptidase PqqF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 846 TIGR02110: coenzyme PQQ biosynthesis protein PqqF" amino acids 16 to 751 (736 residues), 511.5 bits, see alignment E=2.5e-157 PF00675: Peptidase_M16" amino acids 31 to 138 (108 residues), 69 bits, see alignment E=1.1e-22 PF05193: Peptidase_M16_C" amino acids 183 to 353 (171 residues), 39.6 bits, see alignment E=1.3e-13 PF22454: PQQ_syn_pqqF_N_2" amino acids 252 to 397 (146 residues), 37.9 bits, see alignment E=4.5e-13 PF22455: PqqF_C_3" amino acids 484 to 623 (140 residues), 111.5 bits, see alignment E=7e-36 PF22456: PqqF-like_C_4" amino acids 693 to 771 (79 residues), 83.4 bits, see alignment E=2.6e-27

Best Hits

KEGG orthology group: None (inferred from 67% identity to psa:PST_1978)

Predicted SEED Role

"Coenzyme PQQ synthesis protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNK6 at UniProt or InterPro

Protein Sequence (846 amino acids)

>Psest_2382 coenzyme PQQ biosynthesis probable peptidase PqqF (Pseudomonas stutzeri RCH2)
MTPGSIPSDLLPVRRTLPNGLRLGFIQLSAGSQAAALVRVHAGAHDAPGEYPGLAHFLEH
LLFLGSRAYAASESLMPFVQGHAGQLNASTRERHTDFFFQISADVFDDALKRLLDMLARP
LLDEAAQLREREVLQAEFLARGRDRETLCDAAIGTALSAPHPFSAFHAGNRDTLAVESPA
FQQALKGYHQRFYHCGQMELLIAAPCGIEHLLELLQCAECQLPVAPTVSRQTAPLRVNDG
VALRLQVEGARPLLDLAFALDGLPDETCVALDVLGSWLASQASGSLCMAMRDAGWCEALA
LRVPYWHDGQGVVVVELQLTGQGMAHRAELVAAIRSWLRYMTSQAPWPELWDEYVQIRQR
GLLGKEPLALLRYWADPAAWAPSIDANRVQHALQTLGAQLDGSKPIILTVGEERGDHSAD
TIAANAGFALNMLPERLPVATSQARQWQLPERNPWLSRQIQPRVSPVVLPALCWLEHGDD
PRGQGALYLRWRFAAGRPPAGLWHVLHAALRVHTVAAAQTGVELRFDDLGGSWCLALFGY
AEALPLVLHDLLDVLKMPRVAAFSDGQRLFDEAKVPGADEILIRQLLRRLPVLAEPPVVD
GSTLQDQCALERVWQVSRWDALAVGLPARLSGPLQDALGAMPGLAEPVAERQAERPPRYL
WSRFGDPGAEHALVLFCPLPVRSASVEAAWRQLARLMESAFFRRLRSELQLGYAVFCGFR
QLGERAGIVFAVQSPSAPAGEILGHIETFLQSFSAGLEASSDKVLEAISTGESPNGLSHD
LRRRAEAVWQARLAGFDAEHPQAVAAAMPTGDVSAIKAQLQALRAADGGWHVVANADAPD
GRWQQR