Protein Info for Psest_2379 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 869 PF13188: PAS_8" amino acids 101 to 130 (30 residues), 15.7 bits, see alignment (E = 4.6e-06) amino acids 218 to 259 (42 residues), 20.2 bits, see alignment 1.8e-07 PF12860: PAS_7" amino acids 103 to 204 (102 residues), 51.3 bits, see alignment E=5e-17 amino acids 223 to 324 (102 residues), 57.4 bits, see alignment E=6.2e-19 TIGR00229: PAS domain S-box protein" amino acids 328 to 452 (125 residues), 53.2 bits, see alignment E=1.6e-18 PF08448: PAS_4" amino acids 339 to 447 (109 residues), 89.9 bits, see alignment E=5.2e-29 PF00512: HisKA" amino acids 505 to 568 (64 residues), 38.7 bits, see alignment 3.3e-13 PF02518: HATPase_c" amino acids 613 to 722 (110 residues), 84.9 bits, see alignment E=2.2e-27 PF00072: Response_reg" amino acids 747 to 858 (112 residues), 37.1 bits, see alignment E=1.3e-12

Best Hits

KEGG orthology group: None (inferred from 98% identity to psa:PST_1981)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLM9 at UniProt or InterPro

Protein Sequence (869 amino acids)

>Psest_2379 PAS domain S-box (Pseudomonas stutzeri RCH2)
MSPLADPEAGQVAELLARQAELERENHKLKRINAALIERVESSGAGRDASYAAFQHSVEL
AEQVRERTDALNQAMAELKGSNQLLSDARLRAETAHQHLVDAIESISDAFVLFDRDQRIV
LFNRRFKSLWTRTRARINAGTRLAEVRRLAESTGLIVEEHRGKGDEPTVYRLNNGRWVQV
SERPTREGGLVILYTDITEVKVSETMRREQALAQKSRLLQRAVDNLSQGVAMVSAEGALE
LWNRRFLELCGLAPIEAHRPFEEVMADSELTLLTPNSRDARGRPIRELEQRLFDGRVLEI
RTHALPTGGFVNTFTDITERYRHAEALRESERWIRLITDHVPALIAYVSADLTYEFTNKV
YEEWYRWPSDGMLGQSLREVHSGEHWRQLEPYIDRALSGESVSFEMAERNHAGQQRYMLR
SYVPNRQANGEVAGIFVLIQDITDRRRTAEALHQAYQNLEQRVRERTAELTSLNGQLLRE
IDERSHAEARLREAKREAEVANLSKTKFLAAVSHDLLQPLNAARLFTSALLEQPGALNGG
LIRNISNSLEDVENLLGTLVDISKLDAGVIKPDIAPFAVSELLENLAMEFRQIAGAEQLQ
LDFIPCSALVRSDIQLLARILRNLLTNAIRYTPKGRVLLGCRRHRQSLSIEVWDTGVGIA
SDKLEEIFQEFKRGEGVRPNQDRGLGLGLAIVEKIARILGHRIRVTSQPGRGSCFAIEVP
LAKRAPKARPEPSTTELVLQRLQGARVWVLDNDTAICAGMRTLLEGWGCKVITALSEEDL
ARQVDNFHAEADLMIADYHLDNGHTGIDVVATVNARRASPLPALMITANYSNELKQQVRE
LGHMLMHKPVRPMKLKTAMCHMLEHGTAG