Protein Info for PGA1_c02450 in Phaeobacter inhibens DSM 17395

Annotation: putative outer membrane efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF02321: OEP" amino acids 88 to 248 (161 residues), 46 bits, see alignment E=2.8e-16 amino acids 272 to 428 (157 residues), 51.8 bits, see alignment E=4.8e-18

Best Hits

KEGG orthology group: None (inferred from 69% identity to sit:TM1040_0530)

Predicted SEED Role

"Type I secretion system, outer membrane component LapE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DX11 at UniProt or InterPro

Protein Sequence (439 amino acids)

>PGA1_c02450 putative outer membrane efflux protein (Phaeobacter inhibens DSM 17395)
MRGGRMQLGRPIGAVALLCCLSACMQSLPFAKPGEGAETDVSRRASSFAQPDAKNPSVVI
SNLMQRQSLLEDGSIYDVVAQSTISASARAAEAELTSAKLRAEAKSKNWLPTLGPSVSLT
DLGDLVAGILIEQVLFDNGRRKAERAFAAADVEVAAVNLSIDMNERVETALSLYVSGLRG
AEKAAVGTRALSRMYEFERIVLGRVEGGVSDRADLNVVQSKINGMRSAVATAKDATATAT
AELKAITGQSFAETPSRLHLASPPEAGTYLTVLKTEAEATRSVEQAKMERAGLLPQVSAA
GNVTSDGSGAGLTLDLAQPFGLGTPAALKAIEASKEIAKRQVSEVEEDARRDYSRQMQRL
ASYRRQEAEAATLAQTSRETYRLFQAQFKAGQRSVMDVVSIYEEVVRREHAHIDAKYEVV
LIQLALASDMGLLADGDRI