Protein Info for Psest_2373 in Pseudomonas stutzeri RCH2

Annotation: sulfur relay protein TusD/DsrE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF02635: DsrE" amino acids 1 to 127 (127 residues), 68.3 bits, see alignment E=3.3e-23 TIGR03012: sulfur relay protein TusD/DsrE" amino acids 2 to 127 (126 residues), 148 bits, see alignment E=6.5e-48

Best Hits

Swiss-Prot: 80% identical to TUSD_PSEAE: Sulfurtransferase TusD homolog (tusD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07235, tRNA 2-thiouridine synthesizing protein D [EC: 2.8.1.-] (inferred from 80% identity to pmy:Pmen_2377)

MetaCyc: 45% identical to DsrE (Allochromatium vinosum)

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusD"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GND8 at UniProt or InterPro

Protein Sequence (130 amino acids)

>Psest_2373 sulfur relay protein TusD/DsrE (Pseudomonas stutzeri RCH2)
MKFVIALFAPPHSPAARRALRFAEAVLAGGHEIVRLFFYQDGVHSASANVVAAQDELDVA
AEWSRFVSANQLDGVVCIAAGLRRGVLDAGEAQRYRRPAANLAAGWELSGLGQLHEAAQQ
ADRLVCFGGH