Protein Info for Psest_2372 in Pseudomonas stutzeri RCH2

Annotation: Integral membrane protein, interacts with FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 163 to 186 (24 residues), see Phobius details amino acids 193 to 218 (26 residues), see Phobius details PF01027: Bax1-I" amino acids 19 to 218 (200 residues), 174.9 bits, see alignment E=1e-55

Best Hits

Swiss-Prot: 82% identical to Y2604_PSEAE: Uncharacterized protein PA2604 (PA2604) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06890, (no description) (inferred from 99% identity to psa:PST_1988)

Predicted SEED Role

"Putative TEGT family carrier/transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNJ4 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Psest_2372 Integral membrane protein, interacts with FtsH (Pseudomonas stutzeri RCH2)
MHEHEYALSHTQVEQREVSKVLRNTYGLLAMTLAFSGLVAYMAMQANAAYPNIFVVLIGF
YGLFFLTAKLRNSAWGLVSTFALTGFMGYTLGPILNMYLGLANGGELISSALSMTALVFF
GLSAYVLITRKDMSFLSGFITAGFFVLIGAMLAGFFFQITGLQLAISAGFVLFSSACILF
QTSAIIHGGERNYIMATIGLFVSLYNLFISLLQLLGIFGGDD