Protein Info for Psest_2366 in Pseudomonas stutzeri RCH2

Annotation: Homoserine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00641, homoserine O-acetyltransferase [EC: 2.3.1.31] (inferred from 96% identity to psa:PST_1994)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
L-methionine biosynthesis III (4/4 steps found)
L-homocysteine biosynthesis (2/2 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
superpathway of L-cysteine biosynthesis (fungi) (3/6 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.31

Use Curated BLAST to search for 2.3.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNJ0 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Psest_2366 Homoserine acetyltransferase (Pseudomonas stutzeri RCH2)
MIEIKREKKFFALGEMRLENGERLRNARLCYQVVGTPNRARDNLVLIPSYYGGTHWGSLP
LLGADGPLAGGEYCVVLTNLFGAGWSTSPSNAAPGQGAADFPRVSLLDNVRAQKALLDRL
YGEDWQLALVTGWSMGGMQTLFWAMAYPERVRAILPFCCTAHCWPHNRVFLEGVKAALCA
DAAWLGGRYSVPPERGLRAFGRAYAGWAYSQAFYRQELWRELGFESLEALLDYWEQDHLE
QDANDLLCVLHTWQSADPARSFAAGSLAEALGRVRARSILMPGSSDLYFTVEDARHEAAL
IPGAELRVLESDWGHCAGGPGRGAAAMQQVFAAMAELLGR