Protein Info for HP15_2266 in Marinobacter adhaerens HP15

Annotation: rRNA (guanine-N(2)-)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF08468: MTS_N" amino acids 8 to 158 (151 residues), 109.3 bits, see alignment E=4.1e-35 PF05175: MTS" amino acids 171 to 343 (173 residues), 150.1 bits, see alignment E=9.3e-48 PF13649: Methyltransf_25" amino acids 205 to 307 (103 residues), 31 bits, see alignment E=6.8e-11

Best Hits

Swiss-Prot: 60% identical to RSMC_MARHV: Ribosomal RNA small subunit methyltransferase C (rsmC) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 60% identity to maq:Maqu_1942)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.172 or 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFW0 at UniProt or InterPro

Protein Sequence (348 amino acids)

>HP15_2266 rRNA (guanine-N(2)-)-methyltransferase (Marinobacter adhaerens HP15)
MSLPNSHEVLLRNRHLVQGRLALLGVSAGELLTDLPAGGMAMSEHAGVCASLSGRDGWQI
CFGYDDPALAAGTFDTLVVFLPKARAELDLRLALARWLAAPRARLVLVGEKKEGIAGAVK
QLKAVAPQATKTDSARHCQVWCAENIEPLPEFSLREWMTWTGIDCQSVHLDVAGLPGIFS
LGELDDGTRLLMETLDGAPLRSGPVLDFACGAGVLGAWLHRWQERQGLPRLTIDGIDVQS
QAVICARATYERNGVSGRIMASDGLPGVEGSWPVILSNPPFHSGVRTDLSMTERFLREVV
RHLAPGGEVRLVANSFLPYEPLMKRCIGPVERLRENQRFTVYRAFRRS