Protein Info for HP15_2260 in Marinobacter adhaerens HP15

Annotation: small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 23 to 47 (25 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details PF21088: MS_channel_1st" amino acids 148 to 189 (42 residues), 31.2 bits, see alignment 3.4e-11 PF00924: MS_channel_2nd" amino acids 190 to 259 (70 residues), 79.8 bits, see alignment E=2.6e-26 PF24956: Msl2-3_C" amino acids 264 to 345 (82 residues), 34.8 bits, see alignment E=3.1e-12 PF21082: MS_channel_3rd" amino acids 269 to 351 (83 residues), 39.2 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: None (inferred from 75% identity to maq:Maqu_1936)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFV4 at UniProt or InterPro

Protein Sequence (407 amino acids)

>HP15_2260 small-conductance mechanosensitive channel (Marinobacter adhaerens HP15)
MIGDVMAMVNGWIENFGLLSEAWRVGIVVFALVFGTATVAYIASHIIAALERKFSQTKNL
FDDALLHAARKPVVAFVWLQGVYWAAEVAHKYSEAEIFKANESVLQIGFIFVLVWAVLRL
IKEAEGILVSPLKMKQPMDYTTVNAVSKLSRAVVLITAVLIAMQSMGYSISGVLAFGGVG
GIAVGFAAKDLLANFFGGFIIHLDRPFKVGDWVRSPDRNIEGTVEHIGWRLTTIRTFDKR
PLYVPNAAFTTIAVENPSRMSNRRIYETIGIRYADVAQMATIVDDIRAMLQQHEDIESDE
TLIVNFLAFNASSLDIMVYCFTKTTQWVPFHEVKQDVLLKISDIIEGYGAEVAFPTRTLH
LPEGVRLSGSQSDDSADKRGEASSGKSAQKSQNRQTTGDVEDSGESE