Protein Info for Psest_2359 in Pseudomonas stutzeri RCH2

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 121 to 138 (18 residues), see Phobius details amino acids 150 to 166 (17 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 264 to 281 (18 residues), see Phobius details PF00892: EamA" amino acids 9 to 135 (127 residues), 44.6 bits, see alignment E=8.8e-16

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_1999)

Predicted SEED Role

"putative transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM62 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Psest_2359 Predicted permeases (Pseudomonas stutzeri RCH2)
MNSLMPQGMLIGGAIMWGLGWLPLQFFAARGLAGMPLVLLTYSLLSLLALPVLWQQRLQW
ASQYRQVLTMGLCGGWATAALVTALAEGNVVRVMLLFYLAPVWAMVGGWLLLGERLSGTR
LFALGLAMLGIGLTLGITGEALDAPGANDWLALSAGLAFSLNNLATRAADQVPLASKALV
SFIGSALLGGLFCLLFRQSIPPLDLTLTWQIALLALGWLVSMAAVQYGLTHLEAGRAAVL
VVFELIAAVLSSAWFGSHAIGPNEWLGAALITTAALIAGWPERPLPIATRSTCA