Protein Info for HP15_2259 in Marinobacter adhaerens HP15

Annotation: methylthioadenosine phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF01048: PNP_UDP_1" amino acids 9 to 245 (237 residues), 132.7 bits, see alignment E=7.4e-43

Best Hits

Swiss-Prot: 60% identical to MTIP_PSEAE: S-methyl-5'-thioinosine phosphorylase (PA3004) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00772, 5'-methylthioadenosine phosphorylase [EC: 2.4.2.28] (inferred from 77% identity to maq:Maqu_1935)

MetaCyc: 60% identical to S-methyl-5'-thioinosine phosphorylase monomer (Pseudomonas aeruginosa PAO1)
RXN-12241 [EC: 2.4.2.44]

Predicted SEED Role

"5'-methylthioadenosine phosphorylase (EC 2.4.2.28)" in subsystem Methionine Salvage (EC 2.4.2.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.28 or 2.4.2.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFV3 at UniProt or InterPro

Protein Sequence (262 amino acids)

>HP15_2259 methylthioadenosine phosphorylase (Marinobacter adhaerens HP15)
MTSPEKMHPVGIIGGTGLTTLSGLEITGENKAGTPWGMPSAPLVEGRLGDQPVMFLSRHG
NPHRIPPHQVNYRANLKALYDAGVRTVVGVNAVGGIHADMGPAHVVIPDQIIDYTWGRAS
TFFEGSLDSVTHIDFTWPYDESARQILIDAAGAENVPFSGFGVYGATQGPRLETAAEIIR
MERDGCDLVGMTGMPEAALAAELGMRYVCLGLVVNWAAGKSDHIITMEEIEAAIEQGMSG
VKRILEVSMAGLGVLTPLPQSS