Protein Info for PGA1_c02430 in Phaeobacter inhibens DSM 17395

Annotation: type I secretion membrane fusion protein, HlyD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details PF25917: BSH_RND" amino acids 62 to 263 (202 residues), 28.2 bits, see alignment E=2.2e-10 PF25994: HH_AprE" amino acids 91 to 172 (82 residues), 42.8 bits, see alignment E=9.7e-15 TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 183 to 388 (206 residues), 215.6 bits, see alignment E=6.2e-68 PF26002: Beta-barrel_AprE" amino acids 275 to 367 (93 residues), 90.5 bits, see alignment E=9.4e-30

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 77% identity to sit:TM1040_0528)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETH8 at UniProt or InterPro

Protein Sequence (389 amino acids)

>PGA1_c02430 type I secretion membrane fusion protein, HlyD family (Phaeobacter inhibens DSM 17395)
MISTGYDLRETSRGASRIIYLVAGALVVFLLWASFAWVDEIVRADGEVVSSSRSQIVQNL
EGGILAELHVHQGDVVKAGQILARLQDTKFRAAADDLQDRIDALEIKQYRLEAELEGAFD
FNVPEELADRSPGIYTSERALLNARQTDFTSRRDSAREILDQLKDELANMKRLHKKEIVA
LIEVNRSQKSVSDAQAKYNEIGTQSELELAEDYSKTLRELTSYRQELRLAQDQLNRTVIT
SPMAGIVNSLAVTTIGGVIRPGEEIVEIIPLGEEMFVEARVKPENIASVQPGQDATIKLS
AYDYTIYGSLRGKVDFVSADTFEDERNPRAEPYYRVTVKVDRSEFTERQQAIEIRPGMRA
TAELQTGSKTILNYMLKPLYKSREALREP