Protein Info for Psest_2357 in Pseudomonas stutzeri RCH2

Annotation: Short-chain dehydrogenases of various substrate specificities

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF00106: adh_short" amino acids 11 to 198 (188 residues), 149.6 bits, see alignment E=1.6e-47 PF08659: KR" amino acids 12 to 167 (156 residues), 35.2 bits, see alignment E=2.4e-12 PF01370: Epimerase" amino acids 12 to 81 (70 residues), 23 bits, see alignment E=9.9e-09 PF13561: adh_short_C2" amino acids 16 to 258 (243 residues), 160.7 bits, see alignment E=9.6e-51

Best Hits

KEGG orthology group: None (inferred from 95% identity to psa:PST_2001)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNC2 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Psest_2357 Short-chain dehydrogenases of various substrate specificities (Pseudomonas stutzeri RCH2)
MHKALDYSGRCVVITGAAGGIGRGLAQSFAAAGATLELLDRDADALARLADELAGDAPLR
CTALDLGDRQAVQRYADDLACRGLHADVLVNNAGVEYATPLDECSFEADQCWSTLLENNV
GSMQRLTRALLPRLRAGASVINQASIWGLKGVPGFSAYVASKHAVVGLTRSLAWELGPRR
IRVNAVCPGWIATDAAMRSLQVMADANGRSDSAELATILSNQAIPELLTPADLGGTFLFL
GSPLAAALTGQALSVSHGEVMH