Protein Info for Psest_2356 in Pseudomonas stutzeri RCH2

Annotation: Fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 168 to 185 (18 residues), see Phobius details amino acids 190 to 207 (18 residues), see Phobius details PF00487: FA_desaturase" amino acids 39 to 296 (258 residues), 123 bits, see alignment E=9.3e-40

Best Hits

KEGG orthology group: None (inferred from 97% identity to psa:PST_2002)

Predicted SEED Role

"fatty acid desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNI0 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Psest_2356 Fatty acid desaturase (Pseudomonas stutzeri RCH2)
MNAKPLYRYADGRVPNTLAILYTALAYGGGLALLFAANGWLNALGTLLLAHGMIIAAYLI
HEFAHGAIFSVPRHNEWAGNVCSWLCGSCYAEFQDLRKKHMRHHVDRADVITFDSKAFLK
ARPVWFQKLVLALEWAYVPAVELIMHFYVIALPFITDNDKHRARRGKVAAVLAVRTLLFA
GLAALSLKAVLLYAVAWMIMLSVLRFADAYQHTYEAFAVLEDGGKLPDDKRRDRSYEQQN
TYSNVVSERWPALNLLLLNFSFHNAHHEKPVAPWYRLPKLHAELYGSTYNQVIPMRKLLG
SFHRYRVRRVLDDDYGVVSEGPHKADNFYGAVGVSFLTAV