Protein Info for Psest_2355 in Pseudomonas stutzeri RCH2

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13379: NMT1_2" amino acids 30 to 256 (227 residues), 69.4 bits, see alignment E=4.4e-23 PF09084: NMT1" amino acids 44 to 252 (209 residues), 91.2 bits, see alignment E=9.2e-30

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 96% identity to psa:PST_2003)

Predicted SEED Role

"Urea carboxylase-related ABC transporter, periplasmic substrate-binding protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJE8 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Psest_2355 ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components (Pseudomonas stutzeri RCH2)
MSTLRSLNKTLLAAGLAVATLFSPLASQAAEKLKIGTVVWAGYGPFYVADKKDLFKPHGL
DVDLQFFNDPALIPTAMLSRALDGGMLTYDQVVASVAKGLKHRVVMPIDFSNGGDAIVAD
ASIQSVTDFRGKKVGFNPLSPSDFLLAYALQQNGMSDKDINAVNMTPEGIPGAMASGNLP
IGVTYEPNVSQILSMGGGGKFKVVYSSKDAPGLITDVLVFDEAVIAKKPAAIKAMIQGYL
DGLAYMQAHPEESAEIIGEVLGVSAEEAVEQMAGAYNIPLAEMGKSFTPGEDTHSFHGSG
AIIAKLLKDNGQIPTIPDFSKTYDAQFTEALAQ