Protein Info for HP15_2251 in Marinobacter adhaerens HP15

Annotation: Na(+)-translocating NADH-quinone reductase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01938: NADH:ubiquinone oxidoreductase, Na(+)-translocating, C subunit" amino acids 6 to 261 (256 residues), 251.2 bits, see alignment E=5.9e-79 PF04205: FMN_bind" amino acids 151 to 250 (100 residues), 63.9 bits, see alignment E=8.7e-22

Best Hits

Swiss-Prot: 48% identical to NQRC_PSEAE: Na(+)-translocating NADH-quinone reductase subunit C (nqrC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00348, Na+-transporting NADH:ubiquinone oxidoreductase subunit C [EC: 1.6.5.-] (inferred from 88% identity to maq:Maqu_1929)

MetaCyc: 45% identical to Na(+)-translocating NADH-quinone reductase subunit C (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit C (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFU5 at UniProt or InterPro

Protein Sequence (267 amino acids)

>HP15_2251 Na(+)-translocating NADH-quinone reductase subunit C (Marinobacter adhaerens HP15)
MAKAKETVSRTLVVALVLSIAFSVVVSTAAVLLRPAQIQNQNLDIKTNILSAAGMLESGS
SAEQIEDAFARFDVRLVDLDTGEFVEPSDVGVQDPMKYDMYKAASDPQMSTNIPSSEDKA
GIKRRPNVAKVYTMSENGQINRVVLPIHGYGLWSTLYGFISLEGDLNTIEGLGFYAHAET
PGLGGEVDNPRWKRQWVGKEVYNEDRSEPQVRLVKGGVGADAQDKEHKVDALSGATLTSR
GVEQLVNYWMGDRGYAPFLQKLREGEV