Protein Info for Psest_2346 in Pseudomonas stutzeri RCH2

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 141 to 178 (38 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 118 to 290 (173 residues), 76 bits, see alignment E=1.6e-25

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 97% identity to psa:PST_2011)

Predicted SEED Role

"Urea carboxylase-related ABC transporter, permease protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLJ8 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Psest_2346 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component (Pseudomonas stutzeri RCH2)
MPVRIGSAVHRPARSQGRRKPGRLPMRLINRSPSRSGWLALAILPFALLLALYLTSSTQR
LELNPNDKLLPSFGQMSAAVERLAFTPDKRSGDYLFWQDTASSLKRLGIGLAIAAVAGLC
LGIAAGTLPLFSAPLSPLLTVLSMVPPLAILPILFIVFGLGELSKVMLIVIGITPILARD
LEQRAREIPRELLIKAQTLGANTWTLILRLVLPQLMPRLLISLRLVLGSAWLFLIAAEAI
ASTDGLGYRIFLVRRYMAMDVILPYVAWITLLAWAMDFTLRRLTQLLFPWYEGAKA