Protein Info for Psest_0231 in Pseudomonas stutzeri RCH2

Annotation: phosphoesterase, MJ0936 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF12850: Metallophos_2" amino acids 1 to 140 (140 residues), 130.3 bits, see alignment E=3.3e-42 TIGR00040: phosphodiesterase, MJ0936 family" amino acids 1 to 142 (142 residues), 83 bits, see alignment E=1.2e-27

Best Hits

KEGG orthology group: K07095, (no description) (inferred from 95% identity to psa:PST_4015)

Predicted SEED Role

"phosphoesterase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGF2 at UniProt or InterPro

Protein Sequence (151 amino acids)

>Psest_0231 phosphoesterase, MJ0936 family (Pseudomonas stutzeri RCH2)
MRIGLISDTHGLLRPEAAAALQGCAQIIHAGDIGKPQVLDGLRAIAPLEAIRGNIDTAEW
ARELPERLDLRIGGLSLHVLHDLKQLDIDPLVAGIDVVIAGHSHKPKVERRDGVLYVNPG
SAGPRRFSLPISLALLELNDGDAQVELISLS