Protein Info for PGA1_c02420 in Phaeobacter inhibens DSM 17395

Annotation: V8-like Glu-specific endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00089: Trypsin" amino acids 37 to 160 (124 residues), 56.8 bits, see alignment E=3e-19 PF13365: Trypsin_2" amino acids 49 to 197 (149 residues), 46.3 bits, see alignment E=7.6e-16

Best Hits

KEGG orthology group: None (inferred from 57% identity to sit:TM1040_0527)

Predicted SEED Role

"trypsin domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DLF9 at UniProt or InterPro

Protein Sequence (237 amino acids)

>PGA1_c02420 V8-like Glu-specific endopeptidase (Phaeobacter inhibens DSM 17395)
MKRIFAAFAACLLFGMPNSAAAEDPQSSITSVVGWEAVGRLNISGRNMCTGALVAPDLVV
TAAHCVYDPTTGRQVDPTSIRFEAGLNGRRAKAARSITKTVVHPSYQYEQPGDSQLGNDI
AILRLDRPISRKMIQPFELANRPARGASVEVLSYSMAQQNRPNLEQNCHVLARQAQIVVM
TCRVDFGASGAPVFDVVPGRMPRLVSVISAKAAVGNRRVSIGTSFDRTVIAMMRSAS