Protein Info for PGA1_c23290 in Phaeobacter inhibens DSM 17395

Annotation: putative choline/ethanolamine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF01636: APH" amino acids 22 to 226 (205 residues), 57.4 bits, see alignment E=2e-19 PF01633: Choline_kinase" amino acids 23 to 211 (189 residues), 62.9 bits, see alignment E=3.2e-21

Best Hits

KEGG orthology group: None (inferred from 63% identity to ara:Arad_3549)

Predicted SEED Role

"Choline kinase (EC 2.7.1.32)" in subsystem Phosphorylcholine incorporation in LPS (EC 2.7.1.32)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.32

Use Curated BLAST to search for 2.7.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ENZ9 at UniProt or InterPro

Protein Sequence (293 amino acids)

>PGA1_c23290 putative choline/ethanolamine kinase (Phaeobacter inhibens DSM 17395)
MSQSNLLHQIRALPIWQGEITAEPLNGGITNVNYLVTDNSGKYVVRAGDDIPLHQVMRFN
ELSASRAAHAAGLAPAVVHTQQGLTVMEYIESRTLTGDDIRAPAMLPRVLELVKSCHQEV
PGHLRGPALVFWVFHVIRDYTAALQDKNSRHAALAAELATIGNRLEQAAGPFDIVFGHND
LLCGNFLDDGTRLWLIDYDYAGFNSPLFDLGGLASNNGLSEQQELWILETYFGAPVTDDL
LHRYNAMKCASLLRETMWSMVSEITSKIEFDYAAYTASNLARFRAALDDFQNT