Protein Info for HP15_2240 in Marinobacter adhaerens HP15

Annotation: tRNA-dihydrouridine synthase, TIM-barrel, YjbN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR00742: tRNA dihydrouridine synthase A" amino acids 18 to 334 (317 residues), 468.9 bits, see alignment E=4.4e-145 PF01207: Dus" amino acids 22 to 331 (310 residues), 288.3 bits, see alignment E=3.4e-90

Best Hits

Swiss-Prot: 64% identical to DUSA_PSEAE: tRNA-dihydrouridine(20/20a) synthase (dusA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05539, tRNA-dihydrouridine synthase A [EC: 1.-.-.-] (inferred from 82% identity to maq:Maqu_1918)

MetaCyc: 58% identical to tRNA-dihydrouridine synthase A (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"tRNA dihydrouridine synthase A (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFT4 at UniProt or InterPro

Protein Sequence (344 amino acids)

>HP15_2240 tRNA-dihydrouridine synthase, TIM-barrel, YjbN (Marinobacter adhaerens HP15)
MSGIPSQETMLHNSGPSRRFCVAPMMDWTTSHYRYLARQLSRHTLLYTEMVTTGALIHGD
TARFLRHDEAEYPLALQLGGSDAGELAHCARLAQQYGFDEVNLNVGCPSDRVQNNMIGAC
LMGHPDKVAEGVRAMIEATDLPVTVKHRIGIDGRESWDDLCEFVEKVSEAGCRTFIVHAR
IAILEGLSPKENREVPPLKYDWVYRLKAKYPHLEIIINGGIKTFGECHEHLRHTDGVMLG
REAYHNPWLLAGVDPEFFGQAAPVETRHQALRAMLPFIGSELERGVFLTHMSRHLLGLFH
GQPGGRQFRRYISENAHKSGAGLEVIETALEKVREPAAPEIAEA