Protein Info for Psest_0230 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized BCR, YitT family COG1284.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details PF19700: DUF6198" amino acids 28 to 182 (155 residues), 32.7 bits, see alignment E=6.4e-12 PF02588: YitT_membrane" amino acids 28 to 201 (174 residues), 122.3 bits, see alignment E=1.8e-39

Best Hits

KEGG orthology group: None (inferred from 95% identity to psa:PST_4016)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFP4 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Psest_0230 Uncharacterized BCR, YitT family COG1284. (Pseudomonas stutzeri RCH2)
MQPDKSDAAEAERVAAIFVRHPLWEDGLALLTGTALVALGIAFYSHAGLLTGGTVGLAFL
LKYLAGWSFGPAFFLLNLPFYALAIWRMGWKFTLRTVCAVGLVSLFAELTPQWVRFAELN
VIYAAVFGGFAIGIGLLILFRHRASLGGVNILALFLQERFGLRAGTFQMGIDALIVMAAV
FVVPADKVLLSVLGAVALNLVLAINHRADRYMGVS