Protein Info for Psest_2324 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details amino acids 385 to 407 (23 residues), see Phobius details amino acids 414 to 432 (19 residues), see Phobius details amino acids 444 to 462 (19 residues), see Phobius details amino acids 468 to 488 (21 residues), see Phobius details PF14400: Transglut_i_TM" amino acids 25 to 184 (160 residues), 163.4 bits, see alignment E=4.4e-52 PF14402: 7TM_transglut" amino acids 260 to 505 (246 residues), 321.3 bits, see alignment E=4.3e-100

Best Hits

KEGG orthology group: None (inferred from 99% identity to psa:PST_2031)

Predicted SEED Role

"FIG139976: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN93 at UniProt or InterPro

Protein Sequence (508 amino acids)

>Psest_2324 hypothetical protein (Pseudomonas stutzeri RCH2)
MRALTLHLKVLIFLLVALGISITAYQIFVLGIPVTEDETDDLWNIDAKVEFQASPREPVK
LQMYVPPLNQEFVSLNESFISNNYGVSVNRVDGNRRVTWSARRASGNQTLYYRLVLTKRY
SGEQTKATGPIFRDSIPVEGAEKIAAEALLSPIRQHSADVETFISEAIKRVNNPNDDNVK
LLLGGDTSIPNKARVIELLLSIAHVPMERVHTIRLNADQPQTPELWLRSFNGDKWLFFNP
GTGEQGLPNDRLVWWTGDEPLISLEGGRNPQVTFTLNNSEMNAIRLAKLTDENTEAGFLE
YSLYGLPLQTQQTYQIMIMIPIGVLVILILRNLGGLQTLGTFTPVLIALAFRETQIGFGI
ILFTLITALGLSLRSYLEHLKLQMLPRLSVVLTFVVVLIAVISLLSHKLGLERGLSVSLF
PMVILTMTIERLSITWEERGGGHAFKVAVGTLIAASLAFMLMNIRELTYFIFTFPAVLLI
MVGFMLAMGRYRGYRLTELFRFKAFLKD