Protein Info for PGA1_c23070 in Phaeobacter inhibens DSM 17395

Annotation: putative ribose transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 259 to 288 (30 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 317 (272 residues), 133.6 bits, see alignment E=3.7e-43

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 32% identity to ipo:Ilyop_2120)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DSE7 at UniProt or InterPro

Protein Sequence (333 amino acids)

>PGA1_c23070 putative ribose transport system permease protein (Phaeobacter inhibens DSM 17395)
MQAGKLSKYLAGGAIWGFIVLELIFFSVAGEFFSVSDKAFMDTDNMLLLLKQSAPIGIIA
MGMTIVMVNGNIDLSVGAIYAICAIILLDSMTWTMFAGLGNWVIPVAWCLALLTGVVLGA
INGLIVWKTGVDAFIVTLGSMLGYRGLVFMYNGEQPTSHLNWTLVDFAEAQFLGLHTATW
FLLVVTVAIWFLMNRTVHGRNAYAIGNNREAAVNAGIRVGPHMMINFMIIGFLAALSAVV
FYSESGSVNPNDGQLYELWVITAVVLGGTKLTGGAGSIVSTFGGVIAIQLLRKGLAHIGA
DTSTVNLVIGLILIAVLFLDRQLNVKGKEELKV