Protein Info for PGA1_c02380 in Phaeobacter inhibens DSM 17395

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 47 to 68 (22 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 328 to 345 (18 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details

Best Hits

Predicted SEED Role

"Permease of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EIL7 at UniProt or InterPro

Protein Sequence (423 amino acids)

>PGA1_c02380 hypothetical protein (Phaeobacter inhibens DSM 17395)
MGVANSIYKLITDAKAPDQQAADRVATHITALTATKLADGLIDPKLVLAWLLNAIGAPGY
LIGVLVPVRESGSLLPQLALAQRIEQSRQRKYYWAAGSALQGLAALGMAAAALLLPGFWA
GWVILVCLALLAVARSACSASYKDILARTVDKGKRGSVSGTAGTLAASGVFLFAILLSTG
ILPRTTVAISLVVALAGVFWLGSAAIFARLDEPEAAPQEAKGFAPNELLRPLKEDRELRR
YIGTRALLISTALAPPFLVMLGGRNAESGFGNLGLLVLASSVAAIVSSYIWGKLSDRSSR
QTLMISGALSAVTLTMAAAVGWATGAPASVVVAGFVFVAQIAYQGARAGRKTHLTDMDTH
GHTSVYTALSNTMIGVLLLLGGGFGLLADAIGAAPVLAILAMLSGLGAALGTRLSEVQDE
ADD